General Information

  • ID:  hor006491
  • Uniprot ID:  Q9TR93
  • Protein name:  Peptide YY
  • Gene name:  PYY
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
  • Length:  34
  • Propeptide:  YPSKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
  • Signal peptide:  NA
  • Modification:  T11 Phosphoserine;T34 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPY2R, NPY1R
  • Target Unid:  G1TSD5, B6VRS4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9TR93-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006491_AF2.pdbhor006491_ESM.pdb

Physical Information

Mass: 461319 Formula: C177H272N52O56
Absent amino acids: CFIMW Common amino acids: ELRY
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -122.94 Boman Index: -10791
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 63.24
Instability Index: 8291.47 Extinction Coefficient cystines: 5960
Absorbance 280nm: 180.61

Literature

  • PubMed ID:  7984499
  • Title:  Characterization of two forms of peptide YY, PYY(1-36) and PYY(3-36), in the rabbit.